PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 231aa    MW: 24901.4 Da    PI: 8.7092
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080672.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.5e-42441431100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++p  +r da++slvyeA++r+rdPvyG++g il+lqqq+++l+ael+
  XP_011080672.1  44 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPAPQRADAANSLVYEANVRLRDPVYGCMGAILALQQQVQTLQAELN 138
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011080672.1 139 AVRAE 143
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.35943144IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-4244141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRERERFDE IGKKLKTEID AASSLNMGRR HMLGPPGSLN TITPCAACKL LRRRCAEECP  60
FSPYFSPHEP QKFAAVHKVF GASNVSKMLM EVPAPQRADA ANSLVYEANV RLRDPVYGCM  120
GAILALQQQV QTLQAELNAV RAEILRYRYR EAANSIIAST NAALAVSVAE LPQAPPTPTP  180
SPPAPVPPPP TPPPPPSVVV SSTSSTPSLY TSTSSAASYS SISNNHIPYF D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0372383e-42KJ037238.1 Sesamum indicum clone TilSSR_8439 microsatellite sesame_8439 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080672.11e-168PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T53e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A022S0331e-109A0A022S033_ERYGU; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-77LOB domain-containing protein 15